GOT1 Antibody - N-terminal region : HRP
Katalog-Nummer ARP48205_P050-HRP
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
GOT1 Antibody - N-terminal region : HRP (ARP48205_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-GOT1 (ARP48205_P050-HRP) antibody |
|---|
| Publications | Takeda, K., Ishida, A., Takahashi, K. & Ueda, T. Synaptic vesicles are capable of synthesizing the VGLUT substrate glutamate from -alpha-ketoglutarate for vesicular loading. J. Neurochem. 121, 184-96 (2012). WB, Human, Horse, Goat, Rabbit, Rat, Guinea pig, Mouse, Bovine, Yeast, Zebrafish 22309504 Povlsen, J. A. et al. Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation. PLoS One 8, e64093 (2013). WB, Human, Horse, Goat, Rabbit, Rat, Guinea pig, Mouse, Bovine, Yeast, Zebrafish 23704975 |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GOT1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 85% |
| Peptide Sequence | Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-GOT1 (ARP48205_P050-HRP) antibody is Catalog # AAP48205 (Previous Catalog # AAPP13024) |
| Sample Type Confirmation | GOT1 is supported by BioGPS gene expression data to be expressed in NCIH226 |
| Reference | Inoue,K., Diabetes Res. Clin. Pract. 79 (3), E4-E7 (2008) |
|---|---|
| Gene Symbol | GOT1 |
| Gene Full Name | Glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) |
| Alias Symbols | AST1, cCAT, GIG18, cAspAT, ASTQTL1 |
| NCBI Gene Id | 2805 |
| Protein Name | Aspartate aminotransferase, cytoplasmic |
| Description of Target | Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enz |
| Uniprot ID | P17174 |
| Protein Accession # | NP_002070 |
| Nucleotide Accession # | NM_002079 |
| Protein Size (# AA) | 413 |
| Molecular Weight | 46kDa |
| Protein Interactions | UBC; CHRAC1; SBDS; UBE2H; TYMS; MTAP; IDH1; HPRT1; ANXA6; ABI3BP; EGFR; TMEM120A; PC; |
