ELOC Antibody - middle region : FITC
Katalog-Nummer P100962_T100-FITC
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
ELOC Antibody - middle region : FITC (P100962_T100-FITC)
| Datasheets/Manuals | Printable datasheet for anti-ELOC (P100962_T100-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Dog, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TCEB1 |
| Predicted Homology Based on Immunogen Sequence | Dog: 100%; Human: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: AENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ELOC (P100962_T100-FITC) antibody is Catalog # AAP31320 (Previous Catalog # AAPP02070) |
| Sample Type Confirmation | TCEB1 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Reference | Yu,X., et al., (2003) Science 302 (5647), 1056-1060 |
|---|---|
| Gene Symbol | ELOC |
| Gene Full Name | elongin C |
| Alias Symbols | SIII, TCEB1 |
| NCBI Gene Id | 6921 |
| Protein Name | elongin-C |
| Description of Target | This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified. |
| Uniprot ID | Q15369 |
| Protein Accession # | NP_005639 |
| Nucleotide Accession # | NM_005648 |
| Protein Size (# AA) | 112 |
| Molecular Weight | 12kDa |
| Protein Interactions | UBC; TCEB2; FUS; vif; METTL21C; SOCS4; CUL5; PRAME; POP1; MDM2; VHL; ASB18; ASB12; ASB14; ASB15; ASB9; ASB8; ASB7; ASB5; ASB10; ASB16; ASB13; ASB1; ASB3; APEX1; CUL2; Zswim8; ASB2; CPTP; CBX5; MRAS; JTB; RCAN2; SOCS1; CUL3; WNT7B; NEDD8; HIF1A; EFNB3; CYP |
