de en

Reagenzien und Instrumente für die Immunologie Zellbiologie und Molekularbiologie

DOG-1(DOG1.1), APC conjugate, 0.1mg/mL

Drucken

Katalog-Nummer BNCA0725-250

Size : 250uL

Contact local distributor :

Telefonnummer : +1 850 650 7790

Marke : Biotium

Contact local distributor :

Telefonnummer : +1 850 650 7790

DOG-1 / TMEM16A Monoclonal Mouse Antibody (DOG1.1)

Product Attributes

Antibody number	#0725
Antibody reactivity (target)	DOG-1, TMEM16A
Antibody type	Primary
Host species	Mouse
Clonality	Monoclonal
Clone	DOG1.1
Isotype	IgG1, kappa
Molecular weight	~114 kDa
Synonyms	Anoctamin 1; Calcium Activated Chloride Channel; Discovered On Gastrointestinal Stromal Tumors Protein 1; TAOS2; ORAOV2; TMEM16A
Human gene symbol	TMEM16A
Entrez gene ID	55107
SwissProt	Q5XXA6
Unigene	503074
Immunogen	A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
Antibody target cellular localization	Plasma membrane, Nucleus
Verified antibody applications	IHC (FFPE) (verified)
Species reactivity	Human
Antibody application notes	Higher concentration may be required for direct detection using primary antibody conjugates than for indirect detection with secondary antibody, Immunofluorescence: 0.5-1 ug/mL, Immunohistology formalin-fixed 0.25-0.5 ug/mL, Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes, Flow Cytometry 0.5-1 ug/million cells/0.1 mL, Optimal dilution for a specific application should be determined by user
Positive control	Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Shipping condition	Room temperature
Storage Conditions	Store at 2 to 8 °C, Protect fluorescent conjugates from light, Note: store BSA-free antibodies at -10 to -35 °C
Shelf life	Guaranteed for at least 24 months from date of receipt when stored as recommended
Regulatory status	For research use only (RUO)
Antibody/conjugate formulation	Conjugates: 0.1 mg/mL in PBS/0.1% BSA/0.05% azide, HRP conjugates: 0.1 mg/mL in PBS/0.05% BSA, Purified: 0.2 mg/mL in PBS/0.05% BSA/0.05% azide, Purified, BSA-free: 1 mg/mL in PBS without azide
Antibody research areas	Cancer
Tumor expression	Gastrointestinal cancer

Product Description

Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.

Primary antibodies are available purified, or with a selection of fluorescent CF® dyes and other labels. CF® dyes offer exceptional brightness and photostability. See the CF® Dye Brochure for more information. Note: Conjugates of blue fluorescent dyes like CF®405S and CF®405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can give higher non-specific background than other dye colors.

Stock status: Because Biotium offers a large number of antibody and conjugation options, primary antibody conjugates may be made to order. Typical lead times are up to one week for CF® dye and biotin conjugates, and up to 2-3 weeks for fluorescent protein and enzyme conjugates. Please email info@biotrend.com to inquire about stock status and lead times before placing your order.

Catalog number key for antibody number 0725, Anti-DOG-1 (DOG1.1)

Catalog Number Key for Primary Antibody Conjugates

Antibody # prefix	Conjugation	Ex/Em (nm)	Laser line	Detection channel	Dye Features
BNC04	CF®405S	404/431	405	DAPI (microscopy), AF405	CF®405S Features
BNC88	CF®488A	490/515	488	GFP, FITC	CF®488A Features
BNC68	CF®568	562/583	532, 561	RFP, TRITC	CF®568 Features
BNC94	CF®594	593/614	561	Texas Red®	CF®594 Features
BNC40	CF®640R	642/662	633-640	Cy®5	CF®640R Features
BNC47	CF®647	650/665	633-640	Cy®5	CF®647 Features
BNCB	Biotin	N/A	N/A	N/A
BNUB	Purified	N/A	N/A	N/A
BNUM	Purified, BSA-free	N/A	N/A	N/A

Alexa Fluor, Pacific Blue, Pacific Orange, and Texas Red are trademarks or registered trademarks of Thermo Fisher Scientific; Cy is a registered trademark of Cytiva; IRDye, LI-COR, and Odyssey are registered trademarks of LI-COR Bioscience.