DKK1 Antibody - C-terminal region : Biotin
Katalog-Nummer ARP48015_T100-Biotin
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
DKK1 Antibody - C-terminal region : Biotin (ARP48015_T100-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-DKK1 (ARP48015_T100-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human DKK1 |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-DKK1 (ARP48015_T100-Biotin) antibody is Catalog # AAP48015 (Previous Catalog # AAPS20606) |
| Reference | Ai,M., (2005) Mol. Cell. Biol. 25 (12), 4946-4955 |
|---|---|
| Gene Symbol | DKK1 |
| Gene Full Name | Dickkopf 1 homolog (Xenopus laevis) |
| Alias Symbols | SK, DKK-1 |
| NCBI Gene Id | 22943 |
| Protein Name | Dickkopf-related protein 1 |
| Description of Target | DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. |
| Uniprot ID | O94907 |
| Protein Accession # | NP_036374 |
| Nucleotide Accession # | NM_012242 |
| Protein Size (# AA) | 266 |
| Molecular Weight | 26kDa |
| Protein Interactions | KRTAP10-1; LRP6; MDFI; LRP5; DPP4; SMAD9; KREMEN1; CORO1A; CTNNB1; |
