DHX16 Antibody - N-terminal region : HRP
Katalog-Nummer ARP36356_P050-HRP
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
DHX16 Antibody - N-terminal region : HRP (ARP36356_P050-HRP)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-DHX16 (ARP36356_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: RREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLA |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-DHX16 (ARP36356_P050-HRP) antibody is Catalog # AAP36356 |
| Gene Symbol | DHX16 |
|---|---|
| Gene Full Name | DEAH (Asp-Glu-Ala-His) box polypeptide 16 |
| Alias Symbols | DBP2, PRP8, Prp2, DDX16, NMOAS, PRPF2, PRO2014 |
| NCBI Gene Id | 8449 |
| Protein Name | cDNA FLJ53577, highly similar to pre-mRNA-splicing factor ATP-dependentRNA helicase DHX16 (EC 3.6.1.-) EMBL BAG63940.1 |
| Description of Target | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked. Two transcript variants encoding different isoforms have been found for this gene. |
| Uniprot ID | B4DZ28 |
| Protein Accession # | NP_001157711 |
| Nucleotide Accession # | NM_001164239 |
| Protein Size (# AA) | 981 |
| Molecular Weight | 107kDa |
| Protein Interactions | NUDCD1; UBC; GPKOW; SF3B2; DHX38; DGCR14; CSNK2A1; XAB2; HELQ; PYROXD1; NAA40; LSM2; MIF4GD; GON4L; WDR44; EHD2; LSM5; LSM6; GCC2; TCEA2; MTR; GSPT1; GABPB1; APP; COIL; SNRNP27; SNRNP40; SIRT7; MEGF10; Bud13; TADA2A; SRRM2; SRRM1; |
