DHRS12 Antibody - C-terminal region : FITC
Katalog-Nummer ARP70142_P050-FITC
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
DHRS12 Antibody - C-terminal region : FITC (ARP70142_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-DHRS12 (ARP70142_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Cow, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human DHRS12 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Human: 100%; Zebrafish: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: VSSGGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVVLTERWAQGHPAI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-DHRS12 (ARP70142_P050-FITC) antibody is Catalog # AAP70142 |
| Gene Symbol | DHRS12 |
|---|---|
| Alias Symbols | SDR40C1 |
| NCBI Gene Id | 79758 |
| Protein Name | Dehydrogenase/reductase SDR family member 12 |
| Description of Target | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members in this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids and xenobiotics. Alternative splicing results in multiple transcript variants and protein isoforms. |
| Uniprot ID | A0PJE2 |
| Protein Accession # | NP_001257353 |
| Nucleotide Accession # | NM_001270424 |
| Protein Size (# AA) | 317 |
| Molecular Weight | 35kDa |
| Protein Interactions | H3F3A; |
