CYP46A1 Antibody - C-terminal region : Biotin
Katalog-Nummer ARP43670_P050-Biotin
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
CYP46A1 Antibody - C-terminal region : Biotin (ARP43670_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-CYP46A1 (ARP43670_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CYP46A1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CYP46A1 (ARP43670_P050-Biotin) antibody is Catalog # AAP43670 (Previous Catalog # AAPP11659) |
| Reference | Galluzzi,S., (2008) J. Gerontol. A Biol. Sci. Med. Sci. 63 (5), 510-517 |
|---|---|
| Gene Symbol | CYP46A1 |
| Gene Full Name | Cytochrome P450, family 46, subfamily A, polypeptide 1 |
| Alias Symbols | CP46, CYP46 |
| NCBI Gene Id | 10858 |
| Protein Name | Cholesterol 24-hydroxylase |
| Description of Target | CYP46A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.This protein localizes to the endoplasmic reticulum and hydroxylates medium-chain fatty acids such as laurate and myristate.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is expressed in the brain, where it converts cholesterol to 24S-hydroxycholesterol. While cholesterol cannot pass the blood-brain barrier, 24S-hydroxycholesterol can be secreted in the brain into the circulation to be returned to the liver for catabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | Q9Y6A2 |
| Protein Accession # | NP_006659 |
| Nucleotide Accession # | NM_006668 |
| Protein Size (# AA) | 500 |
| Molecular Weight | 57kDa |
