CRLF1 Antibody - middle region : HRP
Katalog-Nummer ARP36673_P050-HRP
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
CRLF1 Antibody - middle region : HRP (ARP36673_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-CRLF1 (ARP36673_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CRLF1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CRLF1 (ARP36673_P050-HRP) antibody is Catalog # AAP36673 (Previous Catalog # AAPP08006) |
| Reference | Crisponi,L., (2007) Am. J. Hum. Genet. 80 (5), 971-981 |
|---|---|
| Gene Symbol | CRLF1 |
| Gene Full Name | Cytokine receptor-like factor 1 |
| Alias Symbols | CLF, NR6, CISS, CISS1, CLF-1, zcytor5 |
| NCBI Gene Id | 9244 |
| Protein Name | Cytokine receptor-like factor 1 |
| Description of Target | CRLF1 belongs to the type I cytokine receptor family. It is cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. The protein may be involved in nervous system development.Defects in CRLF1 are the cause of cold-induced sweating syndrome 1 and Crisponi syndrome. |
| Uniprot ID | O75462 |
| Protein Accession # | NP_004741 |
| Nucleotide Accession # | NM_004750 |
| Protein Size (# AA) | 422 |
| Molecular Weight | 46kDa |
| Protein Interactions | CLCF1; CNTFR; |
