CRLF1 Antibody - middle region : HRP

Katalog-Nummer ARP36673_P050-HRP

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

CRLF1 Antibody - middle region : HRP (ARP36673_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-CRLF1 (ARP36673_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CRLF1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CRLF1 (ARP36673_P050-HRP) antibody is Catalog # AAP36673 (Previous Catalog # AAPP08006)
ReferenceCrisponi,L., (2007) Am. J. Hum. Genet. 80 (5), 971-981
Gene SymbolCRLF1
Gene Full NameCytokine receptor-like factor 1
Alias SymbolsCLF, NR6, CISS, CISS1, CLF-1, zcytor5
NCBI Gene Id9244
Protein NameCytokine receptor-like factor 1
Description of TargetCRLF1 belongs to the type I cytokine receptor family. It is cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. The protein may be involved in nervous system development.Defects in CRLF1 are the cause of cold-induced sweating syndrome 1 and Crisponi syndrome.
Uniprot IDO75462
Protein Accession #NP_004741
Nucleotide Accession #NM_004750
Protein Size (# AA)422
Molecular Weight46kDa
Protein InteractionsCLCF1; CNTFR;