- More Files
- Specification
Product Description
Human CDKN1A partial ORF ( AAH00312.1, 65 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
WERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — CDKN1A
Entrez GeneID
1026GeneBank Accession#
NM_000389Protein Accession#
AAH00312.1Gene Name
CDKN1A
Gene Alias
CAP20, CDKN1, CIP1, MDA-6, P21, SDI1, WAF1, p21CIP1
Gene Description
cyclin-dependent kinase inhibitor 1A (p21, Cip1)
Omim ID
116899Gene Ontology
HyperlinkGene Summary
This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-CDK2 or -CDK4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen (PCNA), a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of CDK2, and may be instrumental in the execution of apoptosis following caspase activation. Two alternatively spliced variants, which encode an identical protein, have been reported. [provided by RefSeq
Other Designations
CDK-interaction protein 1|DNA synthesis inhibitor|OTTHUMP00000016298|cyclin-dependent kinase inhibitor 1A|melanoma differentiation associated protein 6|wild-type p53-activated fragment 1
- Interactome
- Pathway
- Disease