CD302 Recombinant Protein

Katalog-Nummer NCP0198-500ug

Size : 500ug

Marke : Bioworld Technology

Contact local distributor :


Telefonnummer : +1 850 650 7790

Product NameCD302 Recombinant Protein
Catalog No.NCP0198
Swiss-ProtQ8IX05
Host E.coli
TagHis-tag in C-terminal
Restriction sitesNdeI-XhoI
Background
SolublePBS, 4M Urea, PH7.4
Purification&PurityTransferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Concentration≥0.5mg/ml
Product Name :
CD302 Recombinant Protein
Swiss-Prot :
Q8IX05
Host :
E.coli
Tag :
≥0.5mg/ml
Amino acid Sequence :
DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYLSDNH
Restriction sites :
NdeI-XhoI
Background :
CD302,potential multifunctional C-type lectin receptor that may play roles in endocytosis and phagocytosis as well as in cell adhesion and migration.
Soluble :
PBS, 4M Urea, PH7.4
Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Expression vector :
pet-22b(+)
BiowMW :
~17kDa
Note :
For research use only, not for use in diagnostic procedure.
concentration :
≥0.5mg/ml