ARHGAP36 Antibody - N-terminal region : Biotin
Katalog-Nummer ARP52766_P050-Biotin
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
ARHGAP36 Antibody - N-terminal region : Biotin (ARP52766_P050-Biotin)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-ARHGAP36 (ARP52766_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Goat, Horse, Pig, Rabbit, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGAP36. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Goat: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 83%; Rabbit: 93%; Sheep: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: KPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKH |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ARHGAP36 (ARP52766_P050-Biotin) antibody is Catalog # AAP52766 (Previous Catalog # AAPP33726) |
| Gene Symbol | ARHGAP36 |
|---|---|
| Gene Full Name | Rho GTPase activating protein 36 |
| Alias Symbols | FLJ30058, RP13-102H20.1 |
| NCBI Gene Id | 158763 |
| Protein Name | Rho GTPase-activating protein 36 |
| Description of Target | ARHGAP36 is the GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. |
| Uniprot ID | Q6ZRI8 |
| Protein Accession # | NP_659404 |
| Nucleotide Accession # | NM_144967 |
| Protein Size (# AA) | 547 |
| Molecular Weight | 62kDa |
| Protein Interactions | CLN5; |
