ARHGAP36 Antibody - N-terminal region : Biotin

Katalog-Nummer ARP52766_P050-Biotin

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

ARHGAP36 Antibody - N-terminal region : Biotin (ARP52766_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ARHGAP36 (ARP52766_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Goat, Horse, Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ARHGAP36.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGoat: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 83%; Rabbit: 93%; Sheep: 79%
Peptide SequenceSynthetic peptide located within the following region: KPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKH
Concentration0.5 mg/ml
Blocking PeptideFor anti-ARHGAP36 (ARP52766_P050-Biotin) antibody is Catalog # AAP52766 (Previous Catalog # AAPP33726)
Gene SymbolARHGAP36
Gene Full NameRho GTPase activating protein 36
Alias SymbolsFLJ30058, RP13-102H20.1
NCBI Gene Id158763
Protein NameRho GTPase-activating protein 36
Description of TargetARHGAP36 is the GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
Uniprot IDQ6ZRI8
Protein Accession #NP_659404
Nucleotide Accession #NM_144967
Protein Size (# AA)547
Molecular Weight62kDa
Protein InteractionsCLN5;