App Antibody - C-terminal region : HRP
Katalog-Nummer ARP32591_P050-HRP
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
App Antibody - C-terminal region : HRP (ARP32591_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-App (ARP32591_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Mouse, Rat |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human App |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Mouse: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: EVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-App (ARP32591_P050-HRP) antibody is Catalog # AAP32591 (Previous Catalog # AAPP03594) |
| Gene Symbol | App |
|---|---|
| Gene Full Name | Amyloid beta (A4) precursor protein |
| Alias Symbols | A, C, Ag, Abe, bet, Abpp, Adap, Cvap, Abeta, betaApp, E030013M08Rik |
| NCBI Gene Id | 11820 |
| Protein Name | Amyloid beta A4 protein |
| Description of Target | The function of App remains unknown. |
| Uniprot ID | P12023 |
| Protein Accession # | NP_001185754 |
| Nucleotide Accession # | NM_001198825 |
| Protein Size (# AA) | 733 |
| Molecular Weight | 90kDa |
| Protein Interactions | Ranbp9; Cpeb1; Bace1; Snca; Prnp; Gga1; Stub1; Ubc; Kif1a; Mme; Mapk8ip2; Mapk8ip1; Dab1; |
