AKAP8L Antibody - middle region : Biotin
Katalog-Nummer ARP32560_P050-Biotin
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
AKAP8L Antibody - middle region : Biotin (ARP32560_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-AKAP8L (ARP32560_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AKAP8L |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: ALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFY |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-AKAP8L (ARP32560_P050-Biotin) antibody is Catalog # AAP32560 (Previous Catalog # AAPP03563) |
| Gene Symbol | AKAP8L |
|---|---|
| Gene Full Name | A kinase (PRKA) anchor protein 8-like |
| Alias Symbols | HA95, HAP95, NAKAP, NAKAP95 |
| NCBI Gene Id | 26993 |
| Protein Name | A-kinase anchor protein 8-like |
| Description of Target | AKAP8L could play a role in constitutive transport element (CTE)-mediated gene expression. It does not seem to be implicated in the binding of regulatory subunit II of PKA. It may be involved in nuclear envelope breakdown and chromatin condensation. It may regulate the initiation phase of DNA replication when associated with TMPO-beta. |
| Uniprot ID | Q9ULX6 |
| Protein Accession # | NP_055186 |
| Nucleotide Accession # | NM_014371 |
| Protein Size (# AA) | 646 |
| Molecular Weight | 72kDa |
| Protein Interactions | SUMO2; IRS4; UBC; RNF31; SUZ12; RNF2; BMI1; ANKRD28; HDAC11; ILK; vif; EPAS1; BARD1; CAND1; CUL1; CUL2; CUL3; EBNA-LP; Mis12; MYC; PRPF40A; AKAP8L; DHX9; CDC6; PRKACA; LBR; EMD; TMPO; RNF43; MAGED1; RELA; |
