AKAP8 Antibody - middle region : FITC
Katalog-Nummer ARP32755_P050-FITC
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
AKAP8 Antibody - middle region : FITC (ARP32755_P050-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-AKAP8 (ARP32755_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AKAP8 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 92%; Yeast: 83% |
| Peptide Sequence | Synthetic peptide located within the following region: CKFRSFDDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIVNRNKKI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-AKAP8 (ARP32755_P050-FITC) antibody is Catalog # AAP32755 (Previous Catalog # AAPP03769) |
| Sample Type Confirmation | AKAP8 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
| Reference | Olsen,J.V., (2006) Cell 127 (3), 635-648 |
|---|---|
| Gene Symbol | AKAP8 |
| Gene Full Name | A kinase (PRKA) anchor protein 8 |
| Alias Symbols | AKAP-8, AKAP95, AKAP 95, AKAP-95 |
| NCBI Gene Id | 10270 |
| Protein Name | A-kinase anchor protein 8 |
| Description of Target | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. AKAP8 is a member of the AKAP family. It is located in the nucleus during interphase and is distinctly redistributed during mitosis. This protein has a cell cycle-dependent interaction with the RII subunit of PKA.The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is located in the nucleus during interphase and is distinctly redistributed during mitosis. This protein has a cell cycle-dependent interaction with the RII subunit of PKA. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | O43823 |
| Protein Accession # | NP_005849 |
| Nucleotide Accession # | NM_005858 |
| Protein Size (# AA) | 692 |
| Molecular Weight | 76kDa |
| Protein Interactions | SUMO2; UBC; RPA3; RPA2; RPA1; BMI1; RNF2; EZH2; HIPK4; HDAC11; CSNK2A1; MYC; ESR1; BARD1; LRRK2; CAND1; COPS5; CUL3; HNRNPA1; ELAVL1; Mis12; Aurkb; TADA2A; CASP3; DDX5; PRKAR2A; CCND1; RELA; CCND3; CCND2; MCM2; AMY1C; AMY1A; |
