ACAA2 Antibody - N-terminal region : Biotin

Katalog-Nummer ARP48289_P050-Biotin

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

ACAA2 Antibody - N-terminal region : Biotin (ARP48289_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-ACAA2 (ARP48289_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ACAA2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 91%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV
Concentration0.5 mg/ml
Blocking PeptideFor anti-ACAA2 (ARP48289_P050-Biotin) antibody is Catalog # AAP48289 (Previous Catalog # AAPY01658)
ReferenceAboulaich,N., Biochem. J. 383 (PT 2), 237-248 (2004)
Gene SymbolACAA2
Gene Full NameAcetyl-CoA acyltransferase 2
Alias SymbolsDSAEC
NCBI Gene Id10449
Protein Name3-ketoacyl-CoA thiolase, mitochondrial
Description of TargetACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.
Uniprot IDP42765
Protein Accession #NP_006102
Nucleotide Accession #NM_006111
Protein Size (# AA)397
Molecular Weight42kDa
Protein InteractionsSUMO2; UBC; SGTA; P4HB; H2AFZ; TERT; TMEM65; RTN4; ZFR; TAX1BP3; TOMM40; SF3B4; VDAC2; VDAC1; TP53BP1; TIAL1; VAMP2; PFN1; PRDX1; APP; ACO2; ACAT1; SCP2;