ABT1 Antibody - middle region : Biotin

Katalog-Nummer ARP32603_T100-Biotin

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

ABT1 Antibody - middle region : Biotin (ARP32603_T100-Biotin)

Datasheets/ManualsPrintable datasheet for anti-ABT1 (ARP32603_T100-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ABT1
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Zebrafish: 77%
Peptide SequenceSynthetic peptide located within the following region: EVAQAKRETDFYLQSVERGQRFLAADGDPARPDGSWTFAQRPTEQELRAR
Concentration0.5 mg/ml
Blocking PeptideFor anti-ABT1 (ARP32603_T100-Biotin) antibody is Catalog # AAP32603 (Previous Catalog # AAPP03611)
ReferenceOda,T., et al., (2000) Mol. Cell. Biol. 20 (4), 1407-1418
Gene SymbolABT1
Gene Full NameActivator of basal transcription 1
Alias SymbolsEsf2, hABT1
NCBI Gene Id29777
Protein NameActivator of basal transcription 1
Description of TargetBasal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by ABT1 likely activates basal transcription from class II promoters by interaction with TBP and the class II promoter DNA.
Uniprot IDQ9ULW3
Protein Accession #NP_037507
Nucleotide Accession #NM_013375
Protein Size (# AA)272
Molecular Weight31kDa
Protein InteractionsFAM9B; SYNE4; LZTS2; CEP70; CCDC136; CDCA7L; EMD; UBC; PPP1CC; CAND1; PRNP; TBP;